PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0025s0840.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 317aa    MW: 34184.6 Da    PI: 8.3152
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0025s0840.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.23.7e-71972464153
                  DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa...aeaaskrkrelkskkqsals 87 
                             g+++CqdCGnqakkdC h RCRtCCksrgf+C+thvkstWvpa krrerqqqlaa+++++++++   + +++kr+re+ +  +s+l+
  SapurV1A.0025s0840.1.p  97 GGMNCQDCGNQAKKDCPHLRCRTCCKSRGFQCQTHVKSTWVPAGKRRERQQQLAALQQQNQEQQqqfRGENPKRQREN-QGGASSLA 182
                             789*****************************************************9999888833344444444443.45556666 PP

                  DUF702  88 stklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                             +t+l+++  ++ le++ +P+ev+s+avfrcv+vs++dd+e++laYqtav+igGhvf+GiLydqG++
  SapurV1A.0025s0840.1.p 183 CTRLATT--TSGLEMTAFPPEVNSQAVFRCVKVSAMDDAEDQLAYQTAVNIGGHVFRGILYDQGPD 246
                             6665555..56799999***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.3E-6898246IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.2E-26100142IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.9E-26197245IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAGWFYLGGR EGPSSKQDQE KEVNNSSLFL YRSSNEEIYN NNNKGFELWP QYFPQQQNMN  60
SFSFGVGPSR RSISDDHSPG SGFTVMRQGG GGGGLGGGMN CQDCGNQAKK DCPHLRCRTC  120
CKSRGFQCQT HVKSTWVPAG KRRERQQQLA ALQQQNQEQQ QQFRGENPKR QRENQGGASS  180
LACTRLATTT SGLEMTAFPP EVNSQAVFRC VKVSAMDDAE DQLAYQTAVN IGGHVFRGIL  240
YDQGPDGRYT STGGESSSSG AQQLGLITGA TTSTAATTAN TSNPAAGNTL FDPSSLYPAP  300
LNAFIAGTQF FPPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119663e-95AP011966.1 Jatropha curcas DNA, clone: JHL18I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300732.11e-179lateral root primordium family protein
SwissprotQ9LQZ51e-98SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLB9GRH01e-179B9GRH0_POPTR; Lateral root primordium family protein
STRINGPOPTR_0002s03000.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-84SHI-related sequence 5